PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_7B4A6F76A.2
Common NameWBLH1-3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 771aa    MW: 81549.1 Da    PI: 6.7776
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_7B4A6F76A.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-095656021954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Traes_4AL_7B4A6F76A.2 565 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 602
                            554459******************************88 PP

2BELL118.62.8e-38426496272
                   BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            r e q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  Traes_4AL_7B4A6F76A.2 426 RFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 496
                            6799****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF504942.96E-5114198IPR009003Peptidase S1, PA clan
SMARTSM005747.2E-67350494IPR006563POX domain
PfamPF075262.0E-52355493IPR006563POX domain
PROSITE profilePS5007112.6543606IPR001356Homeobox domain
CDDcd000863.37E-13546607No hitNo description
SMARTSM003891.5E-9546610IPR001356Homeobox domain
SuperFamilySSF466892.95E-17548613IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28549612IPR009057Homeodomain-like
PfamPF059203.9E-18563602IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MGIAAPPCQQ TTTQHVGAPR SSAAIYDGRP ATASSMSHSQ GFHQGSSGVY GFSSDGFDRP  60
GSSQQDQQQE HEQQQHHVAQ QSRRDKMRVQ GFDPAAAAAH GLLPIDGDEH VEPGTMYDHA  120
AAAGASNMLA EMFNFSAQTP SGPSATELLA SQMNANYRFG FRQQAPGAVV AGLPGDGGWF  180
GSGGPGRADV VLGGANLLGE TSSPKQQAGG MAGLATDPAA AMQLFLMNPQ QQQQQQSRSS  240
PTSPPPSDAQ SAIQHHEAFQ AYGNAASSFG GGGAGVVEGQ GLSLSLSPSL QQLEMAKQAE  300
ELRVRDGVLY FNRQQQQQQQ QAPSVQQLPM ALHGQVGAMG QQLHVGYGPA GVAGVLRNSK  360
YTRAAQELLD EFCSVGRGQT IKGGGRGAGG SSSNPNASKG GPSSSGAAQS PSSASKEPPQ  420
LSPADRFEQQ RKKAKLISML DEVDRRYNHY CDQMQMVVNF FDSVMGFGAA TPYTALAQKA  480
MSRHFRCLKD AIAAQLRHTC ELLGEKDAGT SSGLTKGETP RLRAIDQSLR QQRAFHHMGM  540
MEQEAWRPQR GLPERSVSIL RSWLFEHFLH PYPSDADKHL LARQTGLSRN QVSNWFINAR  600
VRLWKPMIEE MYQQETKELE GSSAGGGGGG PESGNDPSGA DDLHSPTSTG AQQHPQQQVV  660
MQHGGGRYGQ QEHGMSGVHP HKLDPGAGPS VADAAFVGLD PAELLGGDAH VGAADDLYGR  720
FEPGVRMRYG PATTGAVSGD VSLTLGLQHA GAGNQGPDGS GRFSLRDYSG C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16552609158Homeobox protein Meis1
4xrs_B2e-16552609158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466430.0AB546643.1 Triticum aestivum WBLH1-3 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLD4QFI10.0D4QFI1_WHEAT; BEL1-type homeodomain protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-125BEL1-like homeodomain 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]